The Animal Experiment Of Promoting Wound Repair With Peptide

In the nature, there is a good many polypeptide which have biology activity, polypeptide as one of the important sections constitute of the creature. It is in the physiology and pathologic physiology processes of the organism for regulate the function importantly. Polypeptide as the medicine to have its special advantage: the molecular weight is small, having no immunity original, the structure is simple, side effect is small, it is easy to synthesize, and the production coat is lower, the pure degree of medicine is high, have no pyrogen etc. Therefore, at present in the world use polypeptide for medicine,raccine,enzyme inhibitor, the leading medicine becomes a hot topic of research. In the wound healing process of epidermis organism, the migration ,proliferation and secrete of the epidermis cell are subjected to various cell factor to regulate. The cell factor produces three kinds of living creature effects in wound heading are the function of recruitment, or the function of synthesize and secrete, or the function of proliferation and differentiation. In addition, through direct or indirect way may control outside the cell matrix synthesize and metabolize. The detection of the cell factor and it reasch increasingly thorough, in order to cure the wound,accelerate to wound healing it provides the new path. In recent years, with the study of EGF thorough find that EGF except has the very strong stimulate abruption function for various epidermis cell, it still have the function that make stem cell of epidermis distribute again. We know the epidermis that latent stem cell are the cell sources that the epidermis ascends again. In the normal live body, the epidermis stem cell locates the epidermis basal layer of 1%-10%. But after using EGF, that were found stem cells scattering in the stratum spinosum and stratum granulosum of the epidermis on the wound. During the skin wound healing process, there is finded that An Ji Ao 101 is active with containing 45 amino acid small molecule polypeptide, it is one of thymosinβ, the sequence is NH2-MSDKP DLSEVETFDKSKLKKTNTEEKNTLPSKETIQQEKEYNQRS-COOH,molecular weights is about 5305, synthetic adopt to the solid-phase method,analysis way adopt to HPLC and MS, accord with the molecular weights and sequence of An Ji Ao 101. The experiment adopt to create the animal model, using the special punch of diameter for 2 millimeter, makes the diameter as 2 millimeter standard wound in the back. The experiment time is 2 weeks, measure the wound diameter size in the 4th,7th,10th day, and observe the wound healing time, take the wound and nearby normal skin do the HE pathology and β1 integrin,keratin 19 immunohistochemistry.The experiment result, compare the result of measuring the wound diameter size in the 4th,7th,10th day and the wound healing time, the wound healing of An Ji Ao 101 using many group,positive group are obviously faster than An Ji Ao 101 using only group,negative group, compare each other by statistics way, statistics difference is significant, but compare between the An Ji Ao 101 using many group and the positive group, statistics difference is not significant, compare between the An Ji Ao 101 using only group and the negative group,statistics difference is not significant, explain An Ji Ao 101 using many to obviously promote the wound healing, the effect is similar to rhEGF, though An Ji Ao 101 using only can not promote the wound healing, and statistics difference is not significant comparing with negative group. Comparing the HE pathology of the wound and nearby normal skin each group, the re-epithelialization of An Ji Ao 101 using many group,positive group are obvious than An Ji Ao 101 using only group,negative group,compare each other by statistics way, statistics difference is significant, but compare between the An Ji Ao 101 using many group and the positive group, statistics difference is not significant, compare between the An Ji Ao 101 using only group and the negative group,statistics difference is not significant, explain An Ji Ao 101 using many to obviously promote the re-epithelialization function,but An Ji Ao 101 using only can not promote the re-epithelialization function. Making theβ1 integrin,keratin 19 immunohistochemistry of the wound and nearby normal skin each group, An Ji Ao 101 using only group and the negative group do not see positive cell of b1 integrin,keratin 19, An Ji Ao 101 using many group and the positive group can see positive cell of β1 integrin,keratin 19, see positive cells scattering in the stratum spinosum and stratum granulosum of the epidermis too, explain An Ji Ao 101 using many have the function of making the stem cell of epidermis distribute again, but some of An Ji Ao 101 using many group can not see positive cells scattering in the stratum spinosum and stratum granulosum of the epidermis, cause is not clear, and An Ji Ao 101 using only can not making the stem cell of epidermis distribute again. An Ji Ao 101 makes the stem cell of epidermis distribute again, near to eventually end degree the found stem cells scattering in the stratum spinosum and stratum granulosum of the epidermis a special entopic phenomenon, considering that its mechanism is similar to rhEGF mechanism, may have the following reasons: (1) The stem cell of the epidermis appear leapfrog, then accompany with the start of the body wound repair signal, the epidermis stem cell move toward to the upper epidermis quickly, actively participate to repair wound face. (2) Because of the urgency of the body wound repair, although the epidermis stem cell escapes from the epidermis basal layer and go into divide condition,form the fugacious enlargement...